A5353
Myelin oligodendrocyte glycoprotein Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5353
- Zusätzliche Namen:
- BTN6|BTNL11|MOGIG2|Myelin oligodendrocyte glycoprotein|NRCLP7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
- Uniprot:
- Q16653
- Synonyme:
- BTN6;BTNL11;MOG alpha-5;MOG AluA;MOG AluB;MOG Ig-AluB;MOGIG2;myelin-oligodendrocyte glycoprotein;NRCLP7
- Weitere Details:
- The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Versandbedingungen:
- Blue Ice