LTBR Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5351
Zusätzliche Namen:: D12S370|LT-BETA-R|LTBR|TNF-R-III|TNFCR|TNFR-RP|TNFR2-RP|TNFR3|TNFRSF3
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 47 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD
Uniprot:: P36941
Synonyme:: D12S370;LT-BETA-R;lymphotoxin B receptor;lymphotoxin beta receptor (TNFR superfamily, member 3);Lymphotoxin-beta receptor;TNF-R-III;TNFCR;TNFR-RP;TNFR2-RP;TNFR3;TNFRSF3;tumor necrosis factor C receptor;tumor necrosis factor receptor 2-related protein;tumor necrosis factor receptor superfamily member 3;tumor necrosis factor receptor type III
Weitere Details:: This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during the development of lymphoid and other organs, lipid metabolism, immune response, and programmed cell death. Activity of this receptor has also been linked to carcinogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed.

Versandbedingungen:: Blue Ice