A5337
BAIAP2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5337
- Zusätzliche Namen:
- BAIAP2|BAP2|FLAF3|IRSP53|WAML
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 53kDa/58kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSSGSGTLVSTV
- Uniprot:
- Q9UQB8
- Synonyme:
- BAI1 associated protein 2;BAP2;brain-specific angiogenesis inhibitor 1-associated protein 2;fas ligand-associated factor 3;FLAF3;insulin receptor substrate of 53 kDa;insulin receptor substrate p53/p58;insulin receptor substrate protein of 53 kDa;IRS-58;IRSP53;IRSp53/58;WAML;WASP and MIM like
- Weitere Details:
- The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Versandbedingungen:
- Blue Ice