SLC4A4 / NBC Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5332
Zusätzliche Namen:: hhNMC|HNBC1|KNBC|kNBC1|NBC1|NBC2|NBCe1|NBCe1-A|pNBC|SLC4A4 / NBC|SLC4A5
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 135kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
Uniprot:: Q9Y6R1
Synonyme:: electrogenic sodium bicarbonate cotransporter 1;hhNMC;HNBC1;KNBC;kNBC1;Na(+)/HCO3(-) cotransporter;NBC1;NBC2;NBCe1-A;pNBC;SLC4A5;sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney; sodium bicarbonate cotransporter, pancreas);solute carrier family 4 (sodium bicarbonate cotransporter), member 4;Solute carrier family 4 member 4;solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type;solute carrier family 4, sodium bicarbonate cotransporter, member 5
Weitere Details:: This gene encodes a sodium bicarbonate cotransporter (NBC) involved in the regulation of bicarbonate secretion and absorption and intracellular pH. Mutations in this gene are associated with proximal renal tubular acidosis. Multiple transcript variants encoding different isoforms have been found for this gene.