A5328
S100A12 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5328
- Zusätzliche Namen:
- CAAF1|CAGC|CGRP|ENRAGE|MRP-6|MRP6|p6|S100A12
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 11kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
- Uniprot:
- P80511
- Synonyme:
- CAAF1;CAGC;calcitermin;calcium-binding protein in amniotic fluid 1;calgranulin C;Calgranulin-C;CGRP;EN-RAGE;ENRAGE;extracellular newly identified RAGE-binding protein;migration inhibitory factor-related protein 6;MRP-6;MRP6;neutrophil S100 protein;p6;protein S100-A12;S100 calcium-binding protein A12
- Weitere Details:
- The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.
- Versandbedingungen:
- Blue Ice