REG1A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5327
Zusätzliche Namen:: ICRF|P19|PSP|PSPS|PSPS1|PTP|REG|REG1A
Anwendung:: ELISA, WB
Molekulargewicht:: 15kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWK
Uniprot:: P05451
Synonyme:: ICRF;islet cells regeneration factor;islet of langerhans regenerating protein;lithostathine-1-alpha;P19;Pancreatic stone protein;pancreatic stone protein, secretory;pancreatic thread protein;protein-X;PSP;PSPS;PSPS1;PTP;REG;REG-1-alpha;regenerating islet-derived protein 1-alpha;regenerating protein I alpha
Weitere Details:: This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication.