A5327
REG1A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A5327
- Zusätzliche Namen:
- ICRF|P19|PSP|PSPS|PSPS1|PTP|REG|REG1A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 15kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWK
- Uniprot:
- P05451
- Synonyme:
- ICRF;islet cells regeneration factor;islet of langerhans regenerating protein;lithostathine-1-alpha;P19;Pancreatic stone protein;pancreatic stone protein, secretory;pancreatic thread protein;protein-X;PSP;PSPS;PSPS1;PTP;REG;REG-1-alpha;regenerating islet-derived protein 1-alpha;regenerating protein I alpha
- Weitere Details:
- This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication.
- Versandbedingungen:
- Blue Ice

