PKA C-beta (PRKACB) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5324
Zusätzliche Namen:: CAFD2|PKA C-beta|PKA C-beta (PRKACB)|PKACB
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
Uniprot:: P22694
Synonyme:: CAFD2;cAMP-dependent protein kinase catalytic subunit beta;PKA C-beta;PKACB;protein kinase A catalytic subunit beta;protein kinase, cAMP-dependent, beta catalytic subunit;protein kinase, cAMP-dependent, catalytic, beta
Weitere Details:: The protein encoded by this gene is a member of the serine/threonine protein kinase family. The encoded protein is a catalytic subunit of cAMP (cyclic AMP)-dependent protein kinase, which mediates signalling though cAMP. cAMP signaling is important to a number of processes, including cell proliferaton and differentiation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.