NDRG2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5319
Zusätzliche Namen:: NDRG2|SYLD
Anwendung:: ELISA, WB
Molekulargewicht:: 36kDa/41kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC
Uniprot:: Q9UN36
Synonyme:: cytoplasmic protein Ndr1;N-myc downstream regulator 2;N-myc downstream-regulated gene 2 protein;NDR1-related protein NDR2;protein NDRG2;Protein Syld709613;SYLD;syld709613 protein
Weitere Details:: This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Alternative splicing results in multiple transcript variants.