A5312
FABP3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A5312
- Zusätzliche Namen:
- FABP11|FABP3|H-FABP|M-FABP|MDGI|O-FABP
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
- Uniprot:
- P05413
- Synonyme:
- epididymis secretory sperm binding protein;FABP11;fatty acid binding protein 11;fatty acid binding protein 3, muscle and heart;Fatty acid-binding protein 3;fatty acid-binding protein, heart;H-FABP;heart-type fatty acid-binding protein;M-FABP;mammary-derived growth inhibitor;MDGI;muscle fatty acid-binding protein;O-FABP
- Weitere Details:
- The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice