CPT1A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5307
Zusätzliche Namen:: CPT1|CPT1-L|CPT1A|L-CPT1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 88kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
Uniprot:: P50416
Synonyme:: carnitine O-palmitoyltransferase 1, liver isoform;Carnitine O-palmitoyltransferase I, liver isoform;Carnitine palmitoyltransferase 1A;carnitine palmitoyltransferase 1A (liver);carnitine palmitoyltransferase I, liver;CPT I;CPT1;CPT1-L;CPTI-L;L-CPT1
Weitere Details:: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice