CHRNA1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5306
Zusätzliche Namen:: ACHRA|ACHRD|CHRNA|CHRNA1|CMS1A|CMS1B|CMS2A|FCCMS|SCCMS
Anwendung:: ELISA, WB, IHC-P, IF
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLD
Uniprot:: P02708
Synonyme:: acetylcholine receptor subunit alpha;acetylcholine receptor, nicotinic, alpha 1 (muscle);ACHRA;ACHRD;cholinergic receptor, nicotinic alpha 1;cholinergic receptor, nicotinic, alpha 1 (muscle);cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle);CHRNA;CMS1A;CMS1B;CMS2A;FCCMS;muscle nicotinic acetylcholine receptor;nicotinic acetylcholine receptor alpha subunit;nicotinic cholinergic receptor alpha 1;SCCMS
Weitere Details:: The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha subunits and 1 each of the beta, gamma, and delta subunits. This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified.