A5286
LI Cadherin/Cadherin-17 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5286
- Zusätzliche Namen:
- CDH16|HPT-1|HPT1|LI Cadherin/Cadherin-17
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 120 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALD
- Uniprot:
- Q12864
- Synonyme:
- cadherin 17, LI cadherin (liver-intestine);cadherin-16;cadherin-17;CDH16;HPT-1;HPT-1 cadherin;HPT1;human intestinal peptide-associated transporter HPT-1;human peptide transporter 1;intestinal peptide-associated transporter HPT-1;LI cadherin;liver-intestine cadherin
- Weitere Details:
- This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice