BACE1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5266
Zusätzliche Namen:: ASP2|BACE|BACE1|HSPC104
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGF
Uniprot:: P56817
Synonyme:: APP beta-secretase;asp 2;ASP2;aspartyl protease 2;BACE;beta-secretase 1;beta-secretase 1 precursor variant 1;beta-site amyloid beta A4 precursor protein-cleaving enzyme;Beta-site amyloid precursor protein cleaving enzyme 1;beta-site APP cleaving enzyme 1;beta-site APP-cleaving enzyme;HSPC104;memapsin-2;membrane-associated aspartic protease 2;transmembrane aspartic proteinase Asp2
Weitere Details:: This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. This transmembrane protease catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients.

Versandbedingungen:: Blue Ice