Snail Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5243
Zusätzliche Namen:: dJ710H13.1|SLUGH2|SNA|SNAH|SNAIL|SNAIL1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 29kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
Uniprot:: O95863
Synonyme:: dJ710H13.1;protein sna;protein snail homolog 1;SLUGH2;SNA;SNAH;SNAIL;snail 1 homolog;snail 1 zinc finger protein;snail family zinc finger 1;snail homolog 1;SNAIL1;zinc finger protein SNAI1
Weitere Details:: The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.