TEAD1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5218
Zusätzliche Namen:: AA|NTEF-1|REF1|TCF-13|TCF13|TEAD-1|TEAD1|TEF-1
Anwendung:: ChIP, ELISA, WB, IP, FuncS
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR
Uniprot:: P28347
Synonyme:: AA;NTEF-1;protein GT-IIC;REF1;TCF-13;TCF13;TEA domain family member 1;TEA domain family member 1 (SV40 transcriptional enhancer factor);TEAD-1;TEF-1;transcription factor 13;transcriptional enhancer factor 1;transcriptional enhancer factor TEF-1
Weitere Details:: This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.