A5214
DP1/TFDP1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5214
- Zusätzliche Namen:
- DILC|Dp-1|DP1|DP1/TFDP1|DRTF1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTAGSTSNGTRFSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD
- Uniprot:
- Q14186
- Synonyme:
- DILC;down-regulated in liver cancer stem cells;Dp-1;DP1;DRTF1;DRTF1-polypeptide 1;E2F dimerization partner 1;E2F-related transcription factor;transcription factor Dp-1
- Weitere Details:
- This gene encodes a member of a family of transcription factors that heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. The encoded protein functions as part of this complex to control the transcriptional activity of numerous genes involved in cell cycle progression from G1 to S phase. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1, 15, and X.
- Versandbedingungen:
- Blue Ice