BGAT Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5207
Zusätzliche Namen:: A3GALNT|A3GALT1|BGAT|GTB|NAGAT
Anwendung:: ELISA, WB
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTF
Uniprot:: P16442
Synonyme:: A3GALNT;A3GALT1;ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase);B(A) alpha-1,3-galactosyltransferase;Fucosylglycoprotein 3-alpha-galactosyltransferase;Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase;Glycoprotein-fucosylgalactoside alpha-galactosyltransferase;Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase;GTB;Histo-blood group A transferase;histo-blood group A2 transferase;histo-blood group ABO system transferase;Histo-blood group B transferase;NAGAT
Weitere Details:: This gene encodes proteins related to the first discovered blood group system, ABO. Variation in the ABO gene (chromosome 9q34.2) is the basis of the ABO blood group, thus the presence of an allele determines the blood group in an individual. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene.

Versandbedingungen:: Blue Ice