DHX36 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5191
Zusätzliche Namen:: DDX36|DHX36|G4R1|MLEL1|RHAU
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 114kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIV
Uniprot:: Q9H2U1
Synonyme:: ATP-dependent DNA/RNA helicase DHX36;ATP-dependent RNA helicase DHX36;DDX36;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36;DEAD/H box polypeptide 36;DEAH (Asp-Glu-Ala-His) box polypeptide 36;DEAH box protein 36;G4 resolvase-1;G4-resolvase 1;G4R1;MLE-like protein 1;MLEL1;probable ATP-dependent RNA helicase DHX36;RHAU;RNA helicase associated with AU-rich element ARE;RNA helicase associated with AU-rich element protein
Weitere Details:: This gene is a member of the DEAH-box family of RNA-dependent NTPases which are named after the conserved amino acid sequence Asp-Glu-Ala-His in motif II. The protein encoded by this gene has been shown to enhance the deadenylation and decay of mRNAs with 3'-UTR AU-rich elements (ARE-mRNA). The protein has also been shown to resolve into single strands the highly stable tetramolecular DNA configuration (G4) that can form spontaneously in guanine-rich regions of DNA. Alternative splicing results in multiple transcript variants encoding different isoforms.

Versandbedingungen:: Blue Ice