UBE2F Rabbit polyclonal antibody

Größe

£152.00

SKU:: A5160
Zusätzliche Namen:: NCE2|UBE2F
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR
Uniprot:: Q969M7
Synonyme:: NCE2;NEDD8 carrier protein UBE2F;NEDD8 protein ligase UBE2F;NEDD8-conjugating enzyme 2;NEDD8-conjugating enzyme UBE2F;RING-type E3 NEDD8 transferase UBE2F;Ubiquitin-conjugating enzyme E2 F;ubiquitin-conjugating enzyme E2F (putative)
Weitere Details:: Enables NEDD8 conjugating enzyme activity. Involved in protein neddylation. Predicted to be located in cytosol. Predicted to be active in nucleus.