Rad23A Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5147
Zusätzliche Namen:: HHR23A|HR23A|Rad23A
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
Uniprot:: P54725
Synonyme:: HHR23A;HR23A;RAD23, yeast homolog, A;UV excision repair protein RAD23 homolog A
Weitere Details:: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair. Proteins in this family have a modular domain structure consisting of an ubiquitin-like domain (UbL), ubiquitin-associated domain 1 (UbA1), XPC-binding domain and UbA2. The protein encoded by this gene plays an important role in nucleotide excision repair and also in delivery of polyubiquitinated proteins to the proteasome. Alternative splicing results in multiple transcript variants encoding multiple isoforms.