A5113
ATP1B1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5113
- Zusätzliche Namen:
- ATP1B|ATP1B1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
- Uniprot:
- P05026
- Synonyme:
- adenosinetriphosphatase;ATP1B;ATPase, Na+/K+ transporting, beta 1 polypeptide;Beta 1-subunit of Na(+),K(+)-ATPase;Na, K-ATPase beta-1 polypeptide;sodium pump subunit beta-1;sodium-potassium ATPase subunit beta 1 (non-catalytic);sodium/potassium-dependent ATPase beta-1 subunit;Sodium/potassium-dependent ATPase subunit beta-1;sodium/potassium-transporting ATPase beta-1 chain;sodium/potassium-transporting ATPase subunit beta-1
- Weitere Details:
- The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known.
- Versandbedingungen:
- Blue Ice