A5107
PER2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A5107
- Zusätzliche Namen:
- FASPS|FASPS1|PER2
- Anwendung:
- ChIP, ELISA, WB
- Molekulargewicht:
- 137 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
- Uniprot:
- O15055
- Synonyme:
- circadian clock protein PERIOD 2;FASPS;FASPS1;hPER2;period 2;period circadian clock 2;period circadian protein 2;period circadian protein homolog 2;period homolog 2
- Weitere Details:
- This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders.
- Versandbedingungen:
- Blue Ice



