[KO Validated] ATPIF1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A5099
Zusätzliche Namen:: ATPI|ATPIF1|ATPIP|F1|IP
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
Uniprot:: Q9UII2
Synonyme:: ATP synthase F1 subunit epsilon;ATP synthase inhibitor protein;ATPase inhibitor protein;ATPase inhibitor, mitochondrial;ATPase inhibitory factor 1;ATPI;ATPIF1;ATPIP;IF(1);IF1;inhibitor of F(1)F(o)-ATPase;IP
Weitere Details:: Enables several functions, including ATPase binding activity; angiostatin binding activity; and mitochondrial proton-transporting ATP synthase complex binding activity. Involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Located in cell surface and mitochondrion.