A5097
Cyclophilin 40 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5097
- Zusätzliche Namen:
- Cyclophilin 40|CYP-40|CYPD
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 41kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA
- Uniprot:
- Q08752
- Synonyme:
- 40 kDa peptidyl-prolyl cis-trans isomerase;40 kDa peptidyl-prolyl cis-trans isomerase D;cyclophilin 40;cyclophilin D;Cyclophilin-40;cyclophilin-related protein;CYP-40;CYPD;peptidyl-prolyl cis-trans isomerase D;PPIase D;rotamase D;testicular tissue protein Li 147
- Weitere Details:
- The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A.
- Versandbedingungen:
- Blue Ice