A5078
Brachyury Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5078
- Zusätzliche Namen:
- Brachyury|SAVA|T|TFT
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 49kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQGRLIASWTPVSPPSM
- Uniprot:
- O15178
- Synonyme:
- brachyury protein;protein T;SAVA;T;T brachyury transcription factor;T-box transcription factor T;T, brachyury homolog;TFT
- Weitere Details:
- The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. Variation in this gene was associated with susceptibility to neural tube defects and chordoma. A mutation in this gene was found in a family with sacral agenesis with vertebral anomalies.
- Versandbedingungen:
- Blue Ice