p60 CAF1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5073
Zusätzliche Namen:: CAF-1|CAF-IP60|CAF1|CAF1A|CAF1P60|MPHOSPH7|MPP7|p60 CAF1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP
Uniprot:: Q13112
Synonyme:: CAF-1;CAF-1 subunit B;CAF-I 60 kDa subunit;CAF-I p60;CAF-IP60;CAF1;CAF1A;CAF1P60;chromatin assembly factor 1 subunit B;chromatin assembly factor I p60 subunit;human chromatin assembly factor-I p60 subunit;M-phase phosphoprotein 7;MPHOSPH7;MPP7
Weitere Details:: Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair.