A5071
UPF1/RENT1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5071
- Zusätzliche Namen:
- HUPF1|NORF1|pNORF1|RENT1|smg-2|UPF1/RENT1|UTF
- Anwendung:
- ELISA, WB, IF, ICC, IP
- Molekulargewicht:
- 140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLL
- Uniprot:
- Q92900
- Synonyme:
- ATP-dependent helicase RENT1;delta helicase;HUPF1;nonsense mRNA reducing factor 1;NORF1;pNORF1;regulator of nonsense transcripts 1;RENT1;smg-2;smg-2 homolog, nonsense mediated mRNA decay factor;up-frameshift mutation 1 homolog;up-frameshift suppressor 1 homolog;UPF1 regulator of nonsense transcripts homolog;UTF;yeast Upf1p homolog
- Weitere Details:
- This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice