EEA1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A5057
Zusätzliche Namen:: EEA1|MST105|MSTP105|ZFYVE2
Anwendung:: ELISA, WB
Molekulargewicht:: 170kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLK
Uniprot:: Q15075
Synonyme:: early endosome antigen 1;early endosome antigen 1, 162kD;early endosome-associated protein;endosome-associated protein p162;MST105;MSTP105;ZFYVE2;zinc finger FYVE domain-containing protein 2
Weitere Details:: Enables 1-phosphatidylinositol binding activity; GTP-dependent protein binding activity; and protein homodimerization activity. Involved in endocytosis; vesicle fusion; and viral RNA genome replication. Located in cytosol and early endosome. Is extrinsic component of plasma membrane.