A5012
KPNA2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A5012
- Zusätzliche Namen:
- IPOA1|KPNA2|PTAC58|QIP2|RCH1|SRP1-alpha|SRP1alpha
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 58kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAA
- Uniprot:
- P52292
- Synonyme:
- importin subunit alpha-1;importin subunit alpha-2;importin-alpha-P1;IPOA1;karyopherin alpha 2 (RAG cohort 1, importin alpha 1);Karyopherin subunit alpha-2;pendulin;QIP2;RAG cohort protein 1;RCH1;SRP1-alpha;SRP1alpha
- Weitere Details:
- The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice