Myosin heavy chain Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4963
Zusätzliche Namen:: CMD1S|CMH1|MPD1|MYHCB|Myosin heavy chain|SPMD|SPMM
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 224 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEA
Uniprot:: P12883, P13533
Synonyme:: alpha-MHC;ASD3;cardiac muscle myosin heavy chain 7 beta;CMD1EE;CMD1S;CMH1;CMH14;MPD1;MYHC;myHC-alpha;myHC-beta;myhc-slow;MYHCA;MYHCB;myopathy, distal 1;myosin 7;Myosin heavy chain 6;Myosin heavy chain 7;myosin heavy chain beta-subunit;Myosin heavy chain slow isoform;Myosin heavy chain, cardiac muscle alpha isoform;Myosin heavy chain, cardiac muscle beta isoform;myosin-6;myosin-7;myosin, heavy chain 7, cardiac muscle, beta;myosin, heavy polypeptide 6, cardiac muscle, alpha (cardiomyopathy, hypertrophic 1);myosin, heavy polypeptide 7, cardiac muscle, beta;rhabdomyosarcoma antigen MU-RMS-40.7A;SPMD;SPMM;SSS3
Weitere Details:: Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy. [provided by RefSeq, Jul 2008]

Versandbedingungen:: Blue Ice