Peroxiredoxin 1/PAG Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4956
Zusätzliche Namen:: MSP23|NKEF-A|NKEFA|PAG|PAGA|PAGB|Peroxiredoxin 1/PAG|PRX1|PRXI|TDPX2
Anwendung:: ELISA, WB
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPM
Uniprot:: Q06830
Synonyme:: epididymis secretory sperm binding protein;MSP23;natural killer cell-enhancing factor A;natural killer-enhancing factor A;NKEF-A;NKEFA;PAG;PAGA;PAGB;peroxiredoxin-1;proliferation-associated gene A;proliferation-associated gene protein;PRX1;PRXI;TDPX2;thioredoxin peroxidase 2;thioredoxin-dependent peroxide reductase 2;thioredoxin-dependent peroxiredoxin 1
Weitere Details:: This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene.