A4955
COLEC11 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A4955
- Zusätzliche Namen:
- 3MC2|CL-11|CL-K1-I|CL-K1-II|CL-K1-IIa|CL-K1-IIb|CLK1|COLEC11
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 29kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
- Uniprot:
- Q9BWP8
- Synonyme:
- 3MC2;CL-11;CL-K1-I;CL-K1-II;CL-K1-IIa;CL-K1-IIb;CLK1;Collectin K1;collectin kidney protein 1;collectin sub-family member 11;collectin-11
- Weitere Details:
- This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. The encoded protein binds to multiple sugars with a preference for fucose and mannose. Mutations in this gene are a cause of 3MC syndrome-2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice





