A4941
LMAN1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4941
- Zusätzliche Namen:
- ERGIC-53|ERGIC53|F5F8D|FMFD1|gp58|LMAN1|MCFD1|MR60
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 58kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAA
- Uniprot:
- P49257
- Synonyme:
- endoplasmic reticulum-golgi intermediate compartment protein 53;ER-Golgi intermediate compartment 53 kDa protein;ERGIC-53;ERGIC53;F5F8D;FMFD1;gp58;intracellular mannose-specific lectin MR60;Lectin mannose-binding 1;MCFD1;MR60;protein ERGIC-53
- Weitere Details:
- The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency.
- Versandbedingungen:
- Blue Ice