Creatine kinase B type (CKB) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4907
Zusätzliche Namen:: B-CK|BCK|CKBB|CPK-B|Creatine kinase B type (CKB)|HEL-211|HEL-S-29
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGY
Uniprot:: P12277
Synonyme:: B-CK;BCK;brain creatine kinase;CKBB;CPK-B;creatine kinase B chain;creatine kinase B-type;creatine kinase brain;creatine kinase brain-type;creatine phosphokinase B-type;epididymis luminal protein 211;epididymis secretory protein Li 29;HEL-211;HEL-S-29
Weitere Details:: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.