RHOA/RHOB/RHOC Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4855
Zusätzliche Namen:: ARH9|ARHC|H9|RHOA/RHOB/RHOC|RHOH9
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Uniprot:: P68431, Q16695
Synonyme:: Aplysia ras-related homolog 12;Aplysia RAS-related homolog 6;ARH12;ARH6;ARH9;ARHA;ARHB;ARHC;EDFAOB;epididymis secretory sperm binding protein;H3 histone family, member A;H3 histone family, member B;H3 histone family, member C;H3 histone family, member D;H3 histone family, member F;H3 histone family, member H;H3 histone family, member I;H3 histone family, member J;H3 histone family, member K;H3 histone family, member L;H3 histone family, member T;H3.1;H3.4;H3.f;H3/A;H3/b;H3/c;H3/d;H3/f;H3/g;H3/h;H3/i;H3/j;H3/k;H3/l;H3/t;H3C1;H3C10;H3C11;H3C12;H3C2;H3C3;H3C4;H3C6;H3C7;H3C8;H3F1K;H3FA;H3FB;H3FC;H3FD;H3FF;H3FH;H3FI;H3FJ;H3FK;H3FL;H3FT;H3t;h6;H9;HIST1H3A;HIST1H3B;HIST1H3C;HIST1H3D;HIST1H3E;HIST1H3F;HIST1H3G;HIST1H3H;HIST1H3I;HIST1H3J;HIST3H3;histone 1, H3a;histone 1, H3b;histone 1, H3c;histone 1, H3d;histone 1, H3e;histone 1, H3f;histone 1, H3g;histone 1, H3h;histone 1, H3i;histone 1, H3j;histone 3, H3;histone cluster 1 H3 family member a;histone cluster 1 H3 family member b;histone cluster 1 H3 family member c;histone cluster 1 H3 family member d;histone cluster 1 H3 family member e;histone cluster 1 H3 family member f;histone cluster 1 H3 family member g;histone cluster 1 H3 family member h;histone cluster 1 H3 family member i;histone cluster 1 H3 family member j;histone cluster 1, H3a;histone cluster 1, H3b;histone cluster 1, H3c;histone cluster 1, H3d;histone cluster 1, H3e;histone cluster 1, H3f;histone cluster 1, H3g;histone cluster 1, H3h;histone cluster 1, H3i;histone cluster 1, H3j;histone cluster 3 H3;histone H3.1;histone H3.1t;histone H3.4;histone H3/a;histone H3/b;histone H3/c;histone H3/d;histone H3/f;histone H3/h;histone H3/i;histone H3/j;histone H3/k;histone H3/l;MST081;MSTP081;oncogene RHO H12;oncogene RHO H6;oncogene RHO H9;ras homolog gene family, member B;ras homolog gene family, member C;RAS-related homolog 9;rho cDNA clone 6;rho cDNA clone 9;rho-related GTP-binding protein RhoB;rho-related GTP-binding protein RhoC;RHO12;rhoC GTPase;RHOH12;RHOH6;RHOH9;small GTP binding protein RhoA;small GTP binding protein RhoC;transforming protein RhoA
Weitere Details:: This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Versandbedingungen:: Blue Ice