Histone H3.3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4835
Zusätzliche Namen:: BRYLIB1|H3-3B|H3.3A|H3F3|H3F3A|Histone H3.3
Anwendung:: ChIP, ELISA, WB, IHC-P
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Uniprot:: P84243
Synonyme:: H3 histone family member 3A;H3 histone family member 3B;H3 histone, family 3A;H3 histone, family 3B (H3.3B);H3-3A;H3-3B;H3.3A;H3.3B;H3F3;H3F3A;H3F3B;histone H3.3
Weitere Details:: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded is a replication-independent member of the histone H3 family.