DNAJC15 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4825
Zusätzliche Namen:: DNAJC15|DNAJD1|HSD18|MCJ
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Uniprot:: Q9Y5T4
Synonyme:: cell growth-inhibiting gene 22 protein;DnaJ (Hsp40) homolog, subfamily C, member 15;DnaJ (Hsp40) homolog, subfamily D, member 1;DNAJ domain-containing;dnaJ homolog subfamily C member 15;DNAJD1;HSD18;MCJ;methylation-controlled J protein
Weitere Details:: Predicted to enable ATPase activator activity. Predicted to be involved in protein import into mitochondrial matrix. Predicted to act upstream of or within several processes, including cellular response to starvation; negative regulation of mitochondrial electron transport, NADH to ubiquinone; and negative regulation of protein-containing complex assembly. Predicted to be located in mitochondrial inner membrane. Predicted to be part of PAM complex, Tim23 associated import motor.