A4800
CC2D1A Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A4800
- Zusätzliche Namen:
- Aki-1|CC2D1A|FREUD-1|Freud-1/Aki1|Lgd2|MRT3|TAPE
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 131kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTA
- Uniprot:
- Q6P1N0
- Synonyme:
- Aki-1;Akt kinase-interacting protein 1;coiled-coil and C2 domain-containing protein 1A;five prime repressor element under dual repression-binding protein 1;five repressor element under dual repression-binding protein 1;FRE under dual repression-binding protein 1;FREUD-1;Freud-1/Aki1;Lgd2;MRT3;putative NF-kappa-B-activating protein 023N;putative NFkB activating protein;TAPE;TBK1-associated protein in endolysosomes
- Weitere Details:
- This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5'-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in a nonsyndromic form of cognitive disability (MRT3).
- Versandbedingungen:
- Blue Ice