BAG3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4720
Zusätzliche Namen:: BAG-3|BAG3|BIS|CAIR-1|MFM6
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NDPRVPSEGPKETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRGMPETTQPDKQ
Uniprot:: O95817
Synonyme:: BAG family molecular chaperone regulator 3;BAG-3;Bcl-2-associated athanogene 3;bcl-2-binding protein Bis;Bcl-2-binding protein BIS transcript 2;BCL2 associated athanogene 3;BCL2-binding athanogene 3;BIS;CAIR-1;docking protein CAIR-1;MFM6
Weitere Details:: BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.