NUDC Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A4719
Zusätzliche Namen:: HNUDC|MNUDC|NPD011|NUDC
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
Uniprot:: Q9Y266
Synonyme:: HNUDC;MNUDC;NPD011;nuclear distribution C homolog;nuclear distribution gene C homolog;nuclear distribution protein C homolog;nuclear migration protein nudC;nudC nuclear distribution protein
Weitere Details:: This gene encodes a nuclear distribution protein that plays an essential role in mitosis and cytokinesis. The encoded protein is involved in spindle formation during mitosis and in microtubule organization during cytokinesis. Pseudogenes of this gene are found on chromosome 2.