A4714
BMAL1 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A4714
- Zusätzliche Namen:
- ARNTL|ARNTL1|bHLHe5|BMAL1|BMAL1c|JAP3|MOP3|PASD3|TIC
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 78kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
- Uniprot:
- O00327
- Synonyme:
- ARNT-like protein 1, brain and muscle;aryl hydrocarbon receptor nuclear translocator-like protein 1;basic helix-loop-helix family member e5;basic-helix-loop-helix-PAS orphan MOP3;basic-helix-loop-helix-PAS protein MOP3;bHLH-PAS protein JAP3;bHLHe5;BMAL1;BMAL1c;brain and muscle ARNT-like 1;class E basic helix-loop-helix protein 5;JAP3;member of PAS protein 3;member of PAS superfamily 3;MOP3;PAS domain containing 3;PAS domain-containing protein 3;PASD3;testis tissue sperm-binding protein Li 50e;TIC
- Weitere Details:
- The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. The protein regulates interferon-stimulated gene expression and is an important factor in viral infection, including COVID-19.
- Versandbedingungen:
- Blue Ice

