AK3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A4694
Zusätzliche Namen:: AK3|AK3L1|AK6|AKL3L|AKL3L1|FIX
Anwendung:: ELISA, WB
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Uniprot:: Q9UIJ7
Synonyme:: Adenylate kinase 3;adenylate kinase 3 alpha-like 1;adenylate kinase 6, adenylate kinase 3 like 1;AK3L1;AK6;AKL3L;AKL3L1;FIX;GTP:AMP phosphotransferase AK3, mitochondrial;GTP:AMP phosphotransferase, mitochondrial
Weitere Details:: The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene.