A4689
K-Cadherin (CDH6) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4689
- Zusätzliche Namen:
- CAD6|K-Cadherin (CDH6)|KCAD
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 130kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DIVPEALFLPRRTPTARDNTDVRDFINQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADMYGGVDSDKDS
- Uniprot:
- P55285
- Synonyme:
- CAD6;cadherin 6, type 2, K-cadherin (fetal kidney);cadherin-6;KCAD;Kidney cadherin
- Weitere Details:
- This gene encodes a member of the cadherin superfamily. Cadherins are membrane glycoproteins that mediate homophilic cell-cell adhesion and play critical roles in cell differentiation and morphogenesis. The encoded protein is a type II cadherin and may play a role in kidney development as well as endometrium and placenta formation. Decreased expression of this gene may be associated with tumor growth and metastasis.
- Versandbedingungen:
- Blue Ice