A4662
IFT81 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A4662
- Zusätzliche Namen:
- CDV-1|CDV-1R|CDV1|CDV1R|DV1|IFT81|SRTD19
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 79kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL
- Uniprot:
- Q8WYA0
- Synonyme:
- carnitine deficiency-associated gene expressed in ventricle 1;carnitine deficiency-associated protein expressed in ventricle 1;CDV-1;CDV-1R;CDV1;CDV1R;DV1;intraflagellar transport protein 81 homolog;SRTD19
- Weitere Details:
- The protein encoded by this gene, together with IFT74, forms a tubulin-binding module of intraflagellar transport complex B. This module is involved in transport of tubulin within the cilium, and the encoded protein is required for ciliogenesis. Mutations in this gene are a cause of short-rib polydactyly syndromes.
- Versandbedingungen:
- Blue Ice