UBE2S Rabbit polyclonal antibody

Größe

£152.00

SKU:: A4658
Zusätzliche Namen:: E2-EPF|E2EPF|EPF5|UBE2S
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Uniprot:: Q16763
Synonyme:: E2 ubiquitin-conjugating enzyme S;E2-EPF;E2-EPF5;E2EPF;EPF5;ubiquitin carrier protein S;ubiquitin conjugating enzyme E2S;ubiquitin-conjugating enzyme E2 S;ubiquitin-conjugating enzyme E2-24 kDa;ubiquitin-conjugating enzyme E2-EPF5;ubiquitin-protein ligase S
Weitere Details:: This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.