A4636
GSTO1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4636
- Zusätzliche Namen:
- GSTO 1-1|GSTO1|GSTTLp28|HEL-S-21|P28|SPG-R
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 28 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGK
- Uniprot:
- P78417
- Synonyme:
- epididymis secretory protein Li 21;glutathione S-transferase omega 1-1;glutathione S-transferase omega-1;glutathione-dependent dehydroascorbate reductase;glutathione-S-transferase like;GSTO 1-1;GSTTLp28;HEL-S-21;MMA(V) reductase;monomethylarsonic acid reductase;P28;S-(Phenacyl)glutathione reductase;SPG-R
- Weitere Details:
- The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice