A4620
BLOC1S6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A4620
- Zusätzliche Namen:
- BLOC1S6|BLOS6|HPS9|PA|PALLID|PLDN
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAK
- Uniprot:
- Q9UL45
- Synonyme:
- biogenesis of lysosomal organelles complex-1, subunit 5, pallidin;biogenesis of lysosomal organelles complex-1, subunit 6, pallidin;biogenesis of lysosome-related organelles complex 1 subunit 6;BLOC-1 subunit 6;BLOC-1 subunit pallidin;BLOS6;HPS9;PA;PALLID;pallid protein homolog;Pallidin;PLDN;syntaxin 13 binding protein 1;Syntaxin 13-interacting protein;syntaxin 13-interacting protein pallid
- Weitere Details:
- The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.
- Versandbedingungen:
- Blue Ice