MOB4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A4590
Zusätzliche Namen:: 2C4D|CGI-95|MOB1|MOB3|MOB4|MOBKL3|PHOCN|PREI3
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
Uniprot:: Q9Y3A3
Synonyme:: 2C4D;CGI-95;class II mMOB1;MOB-like protein phocein;MOB1;mob1 homolog 3;MOB1, Mps One Binder kinase activator-like 3;MOB3;MOBKL3;Mps One Binder kinase activator-like 3;phocein, Mob-like protein;PHOCN;PREI3;preimplantation protein 3
Weitere Details:: This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.