A4584
SLC39A6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A4584
- Zusätzliche Namen:
- LIV-1|LIV1|SLC39A6|ZIP6
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 102kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATL
- Uniprot:
- Q13433
- Synonyme:
- estrogen-regulated protein LIV-1;LIV-1;LIV-1 protein, estrogen regulated;LIV1;solute carrier family 39 (metal ion transporter), member 6;solute carrier family 39 (zinc transporter), member 6;Solute carrier family 39 member 6;zinc transporter ZIP6;ZIP-6;ZIP6;zrt- and Irt-like protein 6
- Weitere Details:
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).
- Versandbedingungen:
- Blue Ice