A4566
GSR Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A4566
- Zusätzliche Namen:
- GR|GSR|GSRD|HEL-75|HEL-S-122m
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 56kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
- Uniprot:
- P00390
- Synonyme:
- epididymis luminal protein 75;epididymis secretory sperm binding protein Li 122m;glutathione reductase, mitochondrial;glutathione S-reductase;GR;GRase;GSRD;HEL-75;HEL-S-122m
- Weitere Details:
- This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. This enzyme is a homodimeric flavoprotein. It is a central enzyme of cellular antioxidant defense, and reduces oxidized glutathione disulfide (GSSG) to the sulfhydryl form GSH, which is an important cellular antioxidant. Rare mutations in this gene result in hereditary glutathione reductase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been found.
- Versandbedingungen:
- Blue Ice